• Cheap Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 for sale
    ...Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9 Product introduction: Eptifibatide , is an antiplatelet drug of the glycoprotein IIb/IIIa inhibitor class. Eptifibatide is a cyclic ... more
    Brand Name:VANZ
    Model Number:Medical peptides grade
    Place of Origin:CHINA(MAINLAND)

    Antiplatelet Drug Endocrine System Hormones Eptifibatide Acetate 148031-34-9

    Wuhan Vanz Pharm Inc.
    [Hubei,China]
  • Cheap Bovine Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit for sale
    ... (EG-VEGF) ELISA Kit Traditional ELISA Kit Ready-to-Use ELISA KIT Product name: Bovine Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit Method: Sandwich Synonyms: VEGF; VEGF... more
    Brand Name:DLdevelop
    Model Number:DL-EG-VEGF-b
    Place of Origin:China

    Bovine Endocrine Gland Derived Vascular Endothelial Growth Factor (EG-VEGF) ELISA Kit

  • Cheap CAS 129938-20-1 Golden Male Enhancement Drugs  HCL Endocrine Function Medicine for sale
    ...CAS 129938-20-1 Golden Male Enhancement Drugs HCL Endocrine Function Medicine Basic Info: CAS No: 129938-20-1 MF: C21H23NO. HCl MW: 341.88 Purity: ... more
    Brand Name:kafenbio
    Model Number:129938-20-1
    Place of Origin:China

    CAS 129938-20-1 Golden Male Enhancement Drugs HCL Endocrine Function Medicine

  • Cheap Boldenone Steroids Propionate White Powder For Bodybuilding Anabolic Hormone CAS 977-32-2 for sale
    ....37% Appearance: White powder Usage: Pharmaceutical raw materials, the hormone Function:Hormones and Regulation of Endocrine Function of Drug, Steroid Powder for Bodybuilding Standard: Enterprise Standard. Boldenone Propionate would be more... more
    Brand Name:SR
    Model Number:977-32-2
    Place of Origin:China

    Boldenone Steroids Propionate White Powder For Bodybuilding Anabolic Hormone CAS 977-32-2

  • Cheap Mymi Wonder slim patch weight loss fat burning body shaping for lower body or upper body for sale
    ...Brief Introduction Applied on navel area, the effective herbal ingredients are absorbed by the rich capillary vessel ... more
    Brand Name:Mymi Wonder
    Model Number:slimming patch
    Place of Origin:China

    Mymi Wonder slim patch weight loss fat burning body shaping for lower body or upper body

  • Cheap 98% High quality Lorcaserin  HCL Lorcaserin Hydrochloride/Cas 856681-05-5 for fat loss for sale
    ... Lorcaserin HCL Lorcaserin Hydrochloride/Cas 856681-05-5 for fat loss Lorcaserin Hydrochloride (Cas 856681-05-5) Introduction: Lorcaserin is a prescription medication used to help adults who are obese or who are overweight... more
    Brand Name:Nanjian
    Model Number:98%
    Place of Origin:China

    98% High quality Lorcaserin HCL Lorcaserin Hydrochloride/Cas 856681-05-5 for fat loss

  • Cheap Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder for sale
    ...Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder Introduction: GH-releasing peptides (GHRPs) are synthetic peptides that like GHRH act directly on pituitary somatotrophs ... more
    Brand Name:Sermorelin
    Model Number:87616-84-0
    Place of Origin:china

    Bodybuilding Anabolic Steroids Sermorelin Acetate Peptide White crystalline Powder

    Pharmlab Co.,Ltd
    [Hubei,China]
  • Cheap CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin for sale
    CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin Nandrolone phenylpropionate Synonyms: durabolin Chemical Name: 4-estren-17beta-ol-3-one phenylpropionate CAS NO.: 62-90-8 EINECS: 200-551-9 Assay:99% Molecular Formula... more
    Brand Name:YIHAN
    Model Number:Nandrolone Phenylpropionate
    Place of Origin:China

    CAS 62-90-8 Legal Cutting Steroids To Build Muscle Nandrolone Phenypropionate Durabolin

    Yihan Industrial Co.,Ltd.
    [Hongkong,China]
  • Cheap API Oral Contraceptive Hormone , CAS 68-22-4 Norethisterone For Breast Cancer Cure for sale
    API Oral Contraceptive Hormone Norethisterone For Breast Cancer Cure CAS 68-22-4 Quick detail Product Name Norethisterone Synonyms Norethisterone,98%; 17-alpha-ethynyl-17-beta-hydroxyoestr-4-en-3-one; Norethisterone; 17-ethynyl-17-hydroxyestr-4-en-3-one; ... more
    Brand Name:Jusheng Brand
    Model Number:68-22-4
    Place of Origin:China

    API Oral Contraceptive Hormone , CAS 68-22-4 Norethisterone For Breast Cancer Cure

  • Cheap Fulvestrant Antineoplastic ( hormonal ) Anti Estrogen Steroids White Or Almost White Powder for sale
    Place of Origin: China Certification: ISO9001 CAS:129453-61-8 Molecular Fomular:C32H47F5O3S Molecular Weight:606.77 Molecular Structure: Applications: Many breast cancers are stimulated to grow by the female sex hormones oestrogen and progesterone. These ... more
    Brand Name:Biofriend
    Model Number:129453-61-8
    Place of Origin:China

    Fulvestrant Antineoplastic ( hormonal ) Anti Estrogen Steroids White Or Almost White Powder

  • Cheap Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification for sale
    ...Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification Introduction The Quantum Magnetic Resonance Analyzer replaces the need for ultrasonic, nuclear magnetic resonance or radiography ... more
    Brand Name:huge
    Model Number:Q41
    Place of Origin:China

    Free Software Quantum Resonance Magnetic Analyzer Machine CE Certification

  • Cheap Toremifene Citrate Fareston Anti Estrogen Steroid for Breast Cancer Acapodene for sale
    ...Self Introduction: Our company have been doing this line for more than 10 years, we are experienced ... more
    Brand Name:SMQ
    Model Number:C32H36ClNO8
    Place of Origin:CHINA

    Toremifene Citrate Fareston Anti Estrogen Steroid for Breast Cancer Acapodene

  • Cheap Clomifene Citrate / Clomid Estrogen Blocker Supplement GMP Powder CAS 50-41-9 for sale
    Clomifene citrate / Clomid CAS: 50-41-9 Anti Estrogen Steroids GMP Factory Description: Clomifene citrate (Clomid) Another name:2-4-[2-Chloro-1,2-diphenylethenyl]phenoxy-N,N-diethylethanamine citrate Alias:serophene; pergotime; clomphid; Clomid CAS NO: 50... more
    Brand Name:LSW
    Model Number:50-41-9
    Place of Origin:China

    Clomifene Citrate / Clomid Estrogen Blocker Supplement GMP Powder CAS 50-41-9

  • Cheap Purple Grey Quantum Resonance Magnetic Analyzer Korean Spanish for sale
    Purple Grey Quantum Resonance Magnetic Analyzer Korean Spanish Working with principles of quantum medicine, the Quantum Magnetic Resonance Analyser detects changes in electromagnetic waves emitted by the body’s cells. By holding a sensor in the palm of ... more
    Brand Name:SSCH
    Model Number:GY-D02
    Place of Origin:GUANG DONG, CHINA

    Purple Grey Quantum Resonance Magnetic Analyzer Korean Spanish

  • Cheap CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain for sale
    ...-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29... more
    Brand Name:SGH
    Model Number:86168-78-7
    Place of Origin:China

    CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain

  • Cheap High purity competitive price  Pharmaceutical Grade Raw Peptides Liraglutide Powder For Reduce Blood Glucose for sale
    Pharmaceutical Raw Materials Peptides Liraglutide Powder for reduce blood glucose CAS : 204656-20-2 Product name:Liraglutide Acetate Sequence:H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys(Pal-Gama-Glu)-Glu-Phe-Ile-Ala-... more
    Brand Name:liraglutide
    Model Number:liraglutide
    Place of Origin:China

    High purity competitive price Pharmaceutical Grade Raw Peptides Liraglutide Powder For Reduce Blood Glucose

  • Cheap Energy - Saving Magnetic Knee Support Brace Pad Paste Solid No Deformation for sale
    ... wear, paste solid, no deformation; intermediate layer mosaic with 8 permanent bio-magnet, can fully activate endocrine, analgesic dispelling cold, Expansion of blood vessels, to alleviate the body's local fatigue and pain... more
    Brand Name:ALPINESNOW
    Model Number:Average size
    Place of Origin:China

    Energy - Saving Magnetic Knee Support Brace Pad Paste Solid No Deformation

  • Cheap Anti Wrinkle Radio Frequency Cavitation Machine / Lipo Laser Slimming Equipment for sale
    Anti Wrinkle Radio Frequency Cavitation Machine / Lipo Laser Slimming Equipment Functions: 1. Body slimming, contouring & shaping; 2. Cellulite reduction; 3. Skin Tightening; 4. Wrinkle Removal; 5. Warm Massage; 6. Face shaping and slimming. Applications ... more
    Brand Name:XYY
    Model Number:VF10
    Place of Origin:China(mainland)

    Anti Wrinkle Radio Frequency Cavitation Machine / Lipo Laser Slimming Equipment

  • Cheap Plant Extract Oil Evening Primrose Oil for balancing female endocrine hormones for sale
    ...Introduction Evening primrose originates from Mexico and Central America, now grows abundantly in northeast of China. ... more
    Brand Name:Baili
    Place of Origin:Jilin/China
    Certification:FDA/NOP/GMP/HACCP/ISO9001:2008/ISO22000:2005/KOSHER/HALAL

    Plant Extract Oil Evening Primrose Oil for balancing female endocrine hormones

  • Cheap GD/A19002 Endocrine Organ Model(GD/A19002) for sale
    Introduction Features: The model is mounted on a base and display endocrine gland and endocrine tissue. It consists of pituitary gland, thyroid gland, parathyroid gland, adrenal gland, pancreatic island, testicle and ovary. Material: Advanced PVC more
    Categories:Hyaluronic Acid Injections For Buttocks
    Telephone:86-21-55964925
    Country/Region:china

    GD/A19002 Endocrine Organ Model(GD/A19002)

Tell “endocrine system introduction” Suppliers Your Requirement
*E-mail:
* Message:
Characters Remaining: (0/3000)
Inquiry Cart 0